Protein Info for SMc03797 in Sinorhizobium meliloti 1021

Annotation: homoserine O-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR01001: homoserine O-succinyltransferase" amino acids 24 to 323 (300 residues), 378.4 bits, see alignment E=1.6e-117 PF04204: HTS" amino acids 25 to 321 (297 residues), 430.1 bits, see alignment E=1.9e-133

Best Hits

Swiss-Prot: 100% identical to METAA_RHIME: Homoserine O-acetyltransferase (metAA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00651, homoserine O-succinyltransferase [EC: 2.3.1.46] (inferred from 100% identity to smk:Sinme_3176)

MetaCyc: 84% identical to homoserine O-acetyltransferase (Agrobacterium fabrum C58)
Homoserine O-acetyltransferase. [EC: 2.3.1.31]

Predicted SEED Role

"Homoserine O-succinyltransferase (EC 2.3.1.46)" in subsystem Methionine Biosynthesis (EC 2.3.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.31 or 2.3.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L99 at UniProt or InterPro

Protein Sequence (331 amino acids)

>SMc03797 homoserine O-succinyltransferase (Sinorhizobium meliloti 1021)
MDFRGPVAIVSPPVFLYSIEWTPMPIKIPDTLPAFETLVHEGVRLMTETEAIRQDIRPLQ
IGLLNLMPNKIKTEIQMARLIGATPLQVELTLVRVNGHRPKNTPEEHLLAFYETFEEVEA
RKFDGFIITGAPIETLEYEEVTYWKELQRIFDWTTTNVHSTLNVCWGGMAAVYHFHGVPK
YPLKEKAFGVYRHQNLQPSSVYLNGFSDDFAVPVSRWTEVRRADIDRVPDLEILMESKEV
GVCLVHEKKGNRLYMFNHVEYDSTSLSEEYFRDVDAGVPIKLPHDYFPHNDSALPPQNRW
RSHAHLFFGNWINEIYQTTPYELAKIGTGER