Protein Info for SMc03786 in Sinorhizobium meliloti 1021

Annotation: bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR00754: bacterioferritin" amino acids 1 to 151 (151 residues), 189 bits, see alignment E=2.7e-60 PF00210: Ferritin" amino acids 8 to 144 (137 residues), 114 bits, see alignment E=5.5e-37

Best Hits

Swiss-Prot: 84% identical to BFR_BRUSU: Bacterioferritin (bfr) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03594, bacterioferritin (inferred from 99% identity to smk:Sinme_3165)

MetaCyc: 50% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"Bacterioferritin" in subsystem Iron acquisition in Vibrio

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LA7 at UniProt or InterPro

Protein Sequence (161 amino acids)

>SMc03786 bacterioferritin (Sinorhizobium meliloti 1021)
MKGDAKVIEQLNEALYLELGAVNQYWLHYRLLEDWGYTLLAKKERAESIEEMHHADKLVS
RIIFLEGHPNLQTVAPLRIGQNVKEVLEADLAGEYDARTAYKNSRDICHAAGDYVSMKLF
EELLADEEGHIDFLETQLDLLRKIGEEKYGQLNAASADEAE