Protein Info for SMc03776 in Sinorhizobium meliloti 1021

Annotation: gamma-glutamyl kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR01027: glutamate 5-kinase" amino acids 12 to 371 (360 residues), 394.2 bits, see alignment E=2.9e-122 PF00696: AA_kinase" amino acids 13 to 242 (230 residues), 148.9 bits, see alignment E=2e-47 PF01472: PUA" amino acids 284 to 356 (73 residues), 76.9 bits, see alignment E=9.2e-26

Best Hits

Swiss-Prot: 100% identical to PROB1_RHIME: Glutamate 5-kinase 1 (proB1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to smk:Sinme_3156)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.11

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LB3 at UniProt or InterPro

Protein Sequence (393 amino acids)

>SMc03776 gamma-glutamyl kinase (Sinorhizobium meliloti 1021)
MTKARKALENYRRVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAI
ALGRTVLDLPAGALKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRR
YLNARATIGQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPNARFLETVAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPDHPLAAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKS
LLPAGVRQVTGSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAG
RTAMVHRDDLVMTAPSGARLVEESDEGKGKLHA