Protein Info for SMc03754 in Sinorhizobium meliloti 1021

Annotation: peptide transport system permease ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 159 (28 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 247 to 247 (1 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 85 (85 residues), 52 bits, see alignment E=7.7e-18 PF00528: BPD_transp_1" amino acids 113 to 312 (200 residues), 126.2 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 44% identical to Y4TP_SINFN: Probable peptide ABC transporter permease protein y4tP (NGR_a01430) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to sme:SMc03754)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines, peptides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LE4 at UniProt or InterPro

Protein Sequence (314 amino acids)

>SMc03754 peptide transport system permease ABC transporter protein (Sinorhizobium meliloti 1021)
MIRYLIARILSAIPVIGVVTIVVFGLTYLGPGDAASLMAGDYASPADIAALRVKLHLDDP
IITQYIYWLGNVLKGDFGHSIFSQQPVLALILSRVEPTITLAIAATLVAVVVAVPLGLLA
AHNKGGIADQVVSLFGVAGTAIPAFLIGYLLIFAFGVYYGSMPIAGFAGIESGLLEMAKH
VLLPAIMLGFAQTALISRITRASAIEALNQDFVRVARAKGLDEITIMIWHCLKPIAVPVI
TIVGTSFAHMLGGVVITETVFAIPGIGSLLVEAIQHKDIPVIQGVLLLSSLVYVLVNLLV
DLSYLIVDPRIKYT