Protein Info for SMc03237 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 110 to 126 (17 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 223 to 248 (26 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details PF05977: MFS_3" amino acids 9 to 406 (398 residues), 121.5 bits, see alignment E=3.7e-39 PF07690: MFS_1" amino acids 22 to 323 (302 residues), 92.4 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3139)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LH3 at UniProt or InterPro

Protein Sequence (415 amino acids)

>SMc03237 transport transmembrane protein (Sinorhizobium meliloti 1021)
MSAVHAAHRFAAFRHVGYRRYFFSRLLAYFAVQIMSVAVGWQIYDLTRDPFSLGLIGLFQ
FLPSLVLILVTGSVADRYNRRAIMGICMLVSTLCGAALLLLTVTGLFSPWPVYAILVVFG
IERAFLGPASQSLAPNLVPAEDLPNAIAWNSTSWQTAMIVGPVAGGLLYGFGPTVPYAVS
LGFFAAGALMVFAVPKPARRSPPSAANWQTITAGFRYIKAEKIVLGAISLDLFAVLLGGA
VALMPVFARDVLTLGPWGLGLLRAAPGVGAVGMAVWLAAHPIRNRAGLYMFVGVALFGLA
TVVFGLSATPWISIAALVVMGASDMISVYVREILITLWTPDELRGRVNAVNMVFVGASNE
LGEFRAGMMASGFGTVFAVVFGGAGTLLVSLLWALGFPQLRRIDTLDVPEAQRRG