Protein Info for SMc03229 in Sinorhizobium meliloti 1021

Annotation: NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF03807: F420_oxidored" amino acids 10 to 113 (104 residues), 33.1 bits, see alignment E=1.8e-11 PF01210: NAD_Gly3P_dh_N" amino acids 10 to 164 (155 residues), 128.3 bits, see alignment E=7e-41 PF02558: ApbA" amino acids 11 to 117 (107 residues), 35.6 bits, see alignment E=1.8e-12 PF07479: NAD_Gly3P_dh_C" amino acids 185 to 322 (138 residues), 147.5 bits, see alignment E=8e-47 PF20618: GPD_NAD_C_bact" amino acids 245 to 308 (64 residues), 56.9 bits, see alignment E=6e-19

Best Hits

Swiss-Prot: 100% identical to GPDA_RHIME: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to sme:SMc03229)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R9L6 at UniProt or InterPro

Protein Sequence (333 amino acids)

>SMc03229 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (Sinorhizobium meliloti 1021)
MSGKSKSAPKIVVVGAGAFGTALSAVAAAKDKANVTLLARREEAAAECRRTGRNDAVLPG
IPLPPGLVYSSQAAALEDADIVLFAMPSQAHRDAARSYGPAIGARAIVVTCAKGMEQSTG
QLLTDVLEEELPGRRIGVLSGPGFAADIASGLPTAMVIAAPDTAIATELAEALSGRTFRL
YPSADRTGVQLGGALKNVLAIACGIVEGAGLGDSARAALISRGLAEMSRFIVARGGEADT
VRGLSGLGDLVLTATSHQSRNLRFGIALGKDGRAAAGSSELVEGAFAASVAARVAGALGI
EMPVTEAVAAIVDGKLDVRSALEQLMSRPITHE