Protein Info for SMc03203 in Sinorhizobium meliloti 1021

Updated annotation (from data): Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (2.3.1.168) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: branched-chain alpha-keto acid dehydrogenase E2 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF00364: Biotin_lipoyl" amino acids 6 to 77 (72 residues), 64.4 bits, see alignment E=1e-21 PF02817: E3_binding" amino acids 139 to 173 (35 residues), 54.9 bits, see alignment 1.2e-18 PF00198: 2-oxoacid_dh" amino acids 196 to 423 (228 residues), 267.4 bits, see alignment E=1.5e-83

Best Hits

KEGG orthology group: K09699, 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC: 2.3.1.168] (inferred from 100% identity to sme:SMc03203)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.168

Use Curated BLAST to search for 2.3.1.168

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LT7 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SMc03203 Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (Sinorhizobium meliloti 1021)
MGEFIIKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWL
GAEVGDTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAPPQPEK
PAPKPAPAPREAPDLSAKPLASPAVRLRARESGIDLRQVAGTGPAGRITHEDLDLFISRG
AEPLPAQTGLVRKTAVEEVRMIGLRRRIAEKMSLSTSRIPHITYVEEVDMTALEDLRATM
NRDRKPEQAKLTILPFLMRALVKTVAEQPGVNATFDDHAGVIHRHAAVHIGIATQTPAGL
TVPVVRHAEARGIWDCAAELNRLADAARTGTATRDELTGSTITISSLGAIGGIASTPVIN
HPEVAIVGVNKIAVRPVWDGAQFVPRKIMNLSSSFDHRVIDGWDAAVFVQRLKTLLETPA
LIFVEG