Protein Info for SMc03200 in Sinorhizobium meliloti 1021

Annotation: amino acid deaminase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF01494: FAD_binding_3" amino acids 21 to 51 (31 residues), 22.2 bits, see alignment (E = 2.3e-08) PF01266: DAO" amino acids 22 to 415 (394 residues), 247.1 bits, see alignment E=1.2e-76 PF00890: FAD_binding_2" amino acids 22 to 224 (203 residues), 25.6 bits, see alignment E=2.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2986)

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LU0 at UniProt or InterPro

Protein Sequence (445 amino acids)

>SMc03200 amino acid deaminase transmembrane protein (Sinorhizobium meliloti 1021)
MTMPGPALDLVETDPSLPGSADVVIIGGGIIGVSTALFLAERGVEVVLCEKGVLGGEQSS
RNWGWVRVMGRDRREIPLAMEALKIWDTLDARVGGETGFRRSGILYISETEQDVANRDAW
LAIAKPHGVDSRQLTADETRERMAGAAIRYKGALYTPSDGRAEPQKAVPAIAAGARRAGA
RIVTGCAVRGIEKSAGRVSAVVTEKGRIETSTVVLAGGAWSRLFCKGLGIRLPQLKVRNT
VLRTAPVEGGPDGAGATATYAYRKRIDGGYTIATAGANLHPLVPDTFAFFRDFRAARRAE
GEAVQAGLSAQSWRELFEIASVPLDRPGAFERHRILDPRPDPKSVLKAFEEAKKALPKLR
TVEPVQIWAGLIDVTPDVVPVISLAQELPGLVIATGFSGHGFGIGPGAGHLVADLVTGNP
PIVDPSAFRLSRFADGSPIEIAPPV