Protein Info for SMc03165 in Sinorhizobium meliloti 1021

Updated annotation (from data): Novel Xylose regulator from LacI family
Rationale: Specifically important in carbon source D-Xylose. Also see expression evidence for the putative ortholog from Phaeobacter, PGA1_c13990, which is 41% identical (PMC4148808). (SEED_correct)
Original annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00356: LacI" amino acids 4 to 48 (45 residues), 53 bits, see alignment 2.3e-18 PF13407: Peripla_BP_4" amino acids 65 to 320 (256 residues), 157.1 bits, see alignment E=6.5e-50

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to smk:Sinme_2950)

Predicted SEED Role

"Novel Xylose regulator from LacI family" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LW7 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SMc03165 Novel Xylose regulator from LacI family (Sinorhizobium meliloti 1021)
MRPTVHDIAAEAGVSLATVDRVLNNRPGVRSVTRGKVERAIATLGYVRDVAAANLAKSRS
YPLIFILPAGENSFMRGLEAEVRSAMSRSATERLDITILSVPVFDAPALAAALHDARERR
PAGVAVVAVDAPEVTEAVKRLREDGIAVVTLVSDLPGSGRDHFAGVDNVAAGRTAGSLMG
RFLGGGEGPVAVLAGSMLVRDHRDRLEGFQAVMSEDFAWRRILPVIEGQDNPSLVETLVG
ALLGQHPDLAGIYSLGAGNRGLVAALEKAGKGRAVCTIAHELTPHSRAGLLSGTIDALLN
QNAGHEVRSAIRVLKAKADGLPVIAAQERIRIDIFLKDNLPLEQE