Protein Info for SMc03153 in Sinorhizobium meliloti 1021

Annotation: keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase" amino acids 10 to 209 (200 residues), 248.3 bits, see alignment E=2.2e-78 PF01081: Aldolase" amino acids 10 to 203 (194 residues), 233.5 bits, see alignment E=7.7e-74

Best Hits

Swiss-Prot: 52% identical to ALKH_ECOL6: KHG/KDPG aldolase (eda) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to smk:Sinme_2938)

MetaCyc: 53% identical to 2-dehydro-3-deoxy-phosphogluconate aldolase (Pseudoalteromonas atlantica T6c)
2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.2.14, 4.1.2.55]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.14, 4.1.3.16

Use Curated BLAST to search for 4.1.2.14 or 4.1.2.55 or 4.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LX8 at UniProt or InterPro

Protein Sequence (212 amino acids)

>SMc03153 keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase (Sinorhizobium meliloti 1021)
MSAKTDKLLSILKLQPVVPVLVIDDAGSAVPLARALVAGGLKAIEITLRTPAALEAIRAV
ANEVEGAVAGAGTILNAAQFEEAVAAGSQFIVSPGTTQELIDVANDHEVPLLPGAATASE
VMGLREEGYDVMKFFPAEQAGGAAYLKSLSSPLAGTMFCPTGGISLANARDYLTLPNVVC
VGGSWVAPKDLVVRGDWAGITKLAAEAFALKG