Protein Info for SMc03128 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00528: BPD_transp_1
  • amino acids 110 to 293 (184 residues), 75.6 bits, E=2.1e-25

Best Hits

Swiss-Prot: 34% identical to OPPC_BACSU: Oligopeptide transport system permease protein OppC (oppC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to sme:SMc03128)

MetaCyc: 34% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines, peptides"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

See Q92LR5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SMc03128 ABC transporter permease (Sinorhizobium meliloti 1021)
MASVDLAERSPLAGWLRGSLSFLRRKLPLSVAFGFLWLAAMIVIALFAGYLRPYDITAMD
LTSRLSAPGTLKHWLGTDELGRDVLSRLIQSIRVSLIIAFGATVLSAVFGTALGFAAARF
RGLTEHLVLALADFQAALPFLIMSLAVLAFFGSSMVLLVCLMGFYGWERYARIARGLAIS
AGAQGYAAAVVQLGATPARVYLRHILPNVASTLIVSMTLTFPEIILMESGLSFLGLGVQP
PETSLGNMVGFGREYLTRAPWIMLAPAAVIMLTTLSISLVGDWLRDKLDPTVR