Protein Info for SMc03117 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 48 to 76 (29 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 303 (259 residues), 125.9 bits, see alignment E=8.4e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to sme:SMc03117)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LQ4 at UniProt or InterPro

Protein Sequence (333 amino acids)

>SMc03117 ABC transporter permease (Sinorhizobium meliloti 1021)
MLDMTLTLELAKRKERSPAIVQTVFLGVGLACLLLAPLFFYPVFLMKILCFALFACAFNL
LLGYTGLLSFGHAAFFGGAAYFTAHAVKEWGVPPELGILLGVVGAALLGAVVGFFAIRRQ
GIYFAMITLALAQMFYFFCLQAGFTRGEDGIQSVPRGHLLGFIDLSQPTNMYYFVLAVFV
IGIAMIWRIINSPFGMILKSIRENETRAISLGYSVRNYKLAAFVMSAALTGLAGGLKALV
FQFATLTDVSWQMSGEVILMTLLGGIGTLIGPLFGAGLVVTLQNYLATSEFPVTIITGIV
FMVCVLLFRRGIVGEFYNSRLGRRLGFEHRHKH