Protein Info for SMc03101 in Sinorhizobium meliloti 1021

Annotation: carbon monoxide dehydrogenase small subunit protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF00111: Fer2" amino acids 7 to 60 (54 residues), 28.3 bits, see alignment E=1.4e-10 PF01799: Fer2_2" amino acids 74 to 147 (74 residues), 106.3 bits, see alignment E=7.2e-35

Best Hits

Swiss-Prot: 55% identical to DCMS_HYDPS: Carbon monoxide dehydrogenase small chain (cutS) from Hydrogenophaga pseudoflava

KEGG orthology group: K03518, carbon-monoxide dehydrogenase small subunit [EC: 1.2.99.2] (inferred from 100% identity to sme:SMc03101)

MetaCyc: 58% identical to aldehyde dehydrogenase gamma subunit (Sulfolobus acidocaldarius)
GLYCERALDEHYDE-DEHYDRO-RXN [EC: 1.2.99.8]

Predicted SEED Role

"Carbon monoxide dehydrogenase small chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.99.2 or 1.2.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LP3 at UniProt or InterPro

Protein Sequence (162 amino acids)

>SMc03101 carbon monoxide dehydrogenase small subunit protein (Sinorhizobium meliloti 1021)
MAKITMTVNGRQVSGTCDDRTLLVHFIRENLGLTGTHVGCETTQCGACVVHMDGQSVKSC
SILAAQAAGSAITTIEGLASNGELHPVQAAFKTYHGLQCGFCTPGMVMTAVDMIRRHGGN
LDEATVRAELEGNICRCTGYHNIVQAILAAAAETGGARQAAE