Protein Info for SMc03091 in Sinorhizobium meliloti 1021
Annotation: arginase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to ARGI_AGRFC: Arginase (arcA) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 100% identity to smk:Sinme_3056)MetaCyc: 51% identical to arginase subunit (Agrobacterium tumefaciens)
Arginase. [EC: 3.5.3.1]
Predicted SEED Role
"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)
MetaCyc Pathways
- superpathway of arginine and polyamine biosynthesis (14/17 steps found)
- superpathway of putrescine biosynthesis (4/4 steps found)
- L-arginine degradation VII (arginase 3 pathway) (2/2 steps found)
- putrescine biosynthesis III (2/2 steps found)
- urea cycle (4/5 steps found)
- L-citrulline biosynthesis (6/8 steps found)
- L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)
- L-arginine degradation I (arginase pathway) (2/3 steps found)
- L-canavanine degradation I (1/2 steps found)
- superpathway of L-citrulline metabolism (8/12 steps found)
- superpathway of polyamine biosynthesis I (5/8 steps found)
- L-Nδ-acetylornithine biosynthesis (4/7 steps found)
- superpathway of polyamine biosynthesis II (3/8 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 3.5.3.1
Use Curated BLAST to search for 3.5.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92LN4 at UniProt or InterPro
Protein Sequence (307 amino acids)
>SMc03091 arginase (Sinorhizobium meliloti 1021) MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANH PGANNLQSVAAFARALDEAVHDTARKGHFPIILGGDHALSMGSVSGMARHAQDVGRPLFV LWLDAHADFNSPATSPSGNMHGMPVAFFCGEAEFAPILPKDRPLVDPKKVYQVGIRSVDA REREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPGVG TTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL DRPTRAA