Protein Info for SMc03087 in Sinorhizobium meliloti 1021

Annotation: chemoreceptor methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 TIGR00229: PAS domain S-box protein" amino acids 18 to 127 (110 residues), 60.6 bits, see alignment E=8.2e-21 amino acids 139 to 248 (110 residues), 53.5 bits, see alignment E=1.3e-18 PF08448: PAS_4" amino acids 20 to 124 (105 residues), 41.2 bits, see alignment E=5.3e-14 amino acids 141 to 246 (106 residues), 49.5 bits, see alignment E=1.4e-16 PF13188: PAS_8" amino acids 21 to 63 (43 residues), 15.3 bits, see alignment 4.7e-06 PF00989: PAS" amino acids 21 to 109 (89 residues), 28 bits, see alignment E=5.9e-10 amino acids 148 to 242 (95 residues), 24.7 bits, see alignment E=5.9e-09 PF13426: PAS_9" amino acids 27 to 123 (97 residues), 34 bits, see alignment E=8.8e-12 amino acids 148 to 245 (98 residues), 43.6 bits, see alignment E=9.1e-15 PF08447: PAS_3" amino acids 33 to 117 (85 residues), 51.4 bits, see alignment E=3.3e-17 amino acids 154 to 239 (86 residues), 55.6 bits, see alignment E=1.6e-18 PF00015: MCPsignal" amino acids 358 to 511 (154 residues), 166.6 bits, see alignment E=1.5e-52

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to smk:Sinme_3058)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LN2 at UniProt or InterPro

Protein Sequence (593 amino acids)

>SMc03087 chemoreceptor methyl-accepting chemotaxis protein (Sinorhizobium meliloti 1021)
MFSFTRSRDARQIIDALSKSQAIIQFDLAGNVLDANENFCKALGYSLQEIVGQHHRIFCA
PEFVATEEYREFWARLGRGELDSNSYRRLAKGGREIWIQASYNPVFRNGKPCKVVKFATD
ITAAKMKATEDAGKLDAISRSQAMIEFSPAGEVMTANENFCNTLGYQLSEIQGRHHSMFC
EPGYTGTAEYADFWRRLAQGEFIANEFVRYGKGGKEVWIQAAYNPIRDPNGRVYKVVKFA
TDVTERMAAINSLGAGLRALAEGDLAQSIDTPFVPSMEMVRKDFNEALVRLCRAMQTVGE
NASAIAGGAREIRSAADALSKRTEQQAASVEETAAALDEITTTVADSSRRAEEAGNLVAK
TKDGAERSGLVVKSAIGAMGQIEQSSREISNIIGVIDDIAFQTNLLALNAGVEAARAGEA
GKGFAVVAQEVRELAQRSASAAKDIKTLITASGEHVRNGVSLVGQTGTALETILAQVQEI
NHNVSAIVEAAREQSTGLKEINQAVNAMDQTTQQNAAMVEESTAASHRMSQEADALHALL
RQFRIGRDASPASDNRMEAPHSPTRLHATAKTLRSGTRSNLALAPAADDWENF