Protein Info for SMc03085 in Sinorhizobium meliloti 1021

Annotation: formate dehydrogenase accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 34 to 274 (241 residues), 194.8 bits, E=7.4e-62
• PF02634: FdhD-NarQ
  • amino acids 36 to 274 (239 residues), 251.9 bits, E=3.7e-79

Best Hits

Swiss-Prot: 64% identical to FDHD_AGRFC: Sulfur carrier protein FdhD (fdhD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02379, FdhD protein (inferred from 99% identity to smk:Sinme_3060)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

See Q7APA8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>SMc03085 formate dehydrogenase accessory protein (Sinorhizobium meliloti 1021)
MAGKRVSSSPSGTTATVPEAARRGGILVAQSRVVPEETPVAFTYGGSTHAVMMATPADLE
DFAIGFSLTEGIITGPEQIDDIDIVVEEKGIDLQIRLEDEQNDALRLRRRHMAGPVGCGL
CGIESIDEAVRPTPDVSGSLLRLSEQDVVDAVALLNGQQPLHFETRAVHGAAFYVPGRGL
IAVREDVGRHNALDKLTGAAARAGFRGAQGAVVVTSRVSVEMVQKTAIVGSPVIIAISAP
TALAIRTAEGAGMTLIALVRGDEFEIFTHAERIIRNDEEPASLSARVPLF