Protein Info for SMc03055 in Sinorhizobium meliloti 1021

Annotation: flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 181 to 207 (27 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 10 to 244 (235 residues), 186.7 bits, see alignment E=2.8e-59 PF01311: Bac_export_1" amino acids 10 to 243 (234 residues), 183 bits, see alignment E=3.5e-58

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 99% identity to smk:Sinme_0381)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RY8 at UniProt or InterPro

Protein Sequence (250 amino acids)

>SMc03055 flagellar biosynthesis protein FliR (Sinorhizobium meliloti 1021)
MITDPEGMVLALFAAFCRIGGCVMIMPGFSTARVPMQIRLFIAVALSMAILPIMWTDIYP
QVTGKGHDYLYLVATETAIGAVIGLVARYYVLGLQFAGTAITMLMGFGSPPAADVLEDTA
ENQLTSMIGFAGLMILFMLDFHHVIFEAIAQSYRVMPIGAGFDPQGTLITLTNSLGQTFM
IMLRLASPFVIYGLLFNVAIGMVNKLAPQIPVYFISQPYLIMGGLFLLYLGIAAMLRLFA
DGFAPVMQGG