Protein Info for SMc03054 in Sinorhizobium meliloti 1021

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 17 to 694 (678 residues), 883.7 bits, see alignment E=4e-270 PF00771: FHIPEP" amino acids 28 to 685 (658 residues), 781.1 bits, see alignment E=4.9e-239

Best Hits

Swiss-Prot: 70% identical to FLHA_BRUME: Flagellar biosynthesis protein FlhA (flhA) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 100% identity to sme:SMc03054)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RY9 at UniProt or InterPro

Protein Sequence (695 amino acids)

>SMc03054 flagellar biosynthesis protein FlhA (Sinorhizobium meliloti 1021)
MAQQATLTIPKLAPKSRDVGFALGIVMILSILFLPIPPFLIDLGLAFSISFSVLILMVAL
WIQRPLDFSSFPTILLISTMIRLALNIATTRVILSHGHEGHGAAGGVISGFASLVMSGDF
VIGLIVFLILITVNFIVITKGATRIAEVGARFTLDAIPGKQMSIDADLSAGLIDEKEAQR
RRRELEEESSFFGAMDGASKFVRGDAIAGLIITAINVFGGIIIGYLRHDMEIGEAADVFV
KLSVGDGLVSQIPALIVSLAAGLLISRGGTAGSTDQAVVGQLSGYPRALMVASGLIVLLS
VTPGLPFLPFAALGGGMAFLAWFIPKQIEAEKAAKRDEEAAKAQQSKESDKDSVKSVLKT
AEIELLLGKQVSTRLLGAHQELAFRVGKMRRKFALQYGLVVPEIKVSDDITIPDKAYHVR
IHGTTIASNTVRVGEVLVVTGGGRRPSVPGDDIREPAFGMPAVSILETFTEDLKREGFHP
IDNVSVVLTHLSEVIRNNLPQLLSYKDVKVLIERLDPEYRKLADEICTSHMSYSGLQAVL
KLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEHVRVRMSQQLCGDLADNGVLRVLRL
GNKWDMVFHQALKRDAKGEIVEFDIDPRHLEEFSEQATKVIREHLDRGMPFVLVSSPESR
SYVRMIIERLFATLPVLSHVELAKGLEIKIIGSIS