Protein Info for SMc03047 in Sinorhizobium meliloti 1021

Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 TIGR03506: flagellar hook-basal body protein" amino acids 6 to 387 (382 residues), 307.9 bits, see alignment E=7e-96 PF00460: Flg_bb_rod" amino acids 7 to 37 (31 residues), 47.5 bits, see alignment (E = 2.6e-16) PF22692: LlgE_F_G_D1" amino acids 84 to 157 (74 residues), 45.9 bits, see alignment E=1.1e-15 PF07559: FlgE_D2" amino acids 180 to 285 (106 residues), 45.9 bits, see alignment E=1.7e-15 PF06429: Flg_bbr_C" amino acids 360 to 404 (45 residues), 59.7 bits, see alignment 3.2e-20

Best Hits

Swiss-Prot: 100% identical to FLGE_RHIME: Flagellar hook protein FlgE (flgE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to sme:SMc03047)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9X5Y0 at UniProt or InterPro

Protein Sequence (406 amino acids)

>SMc03047 flagellar hook protein FlgE (Sinorhizobium meliloti 1021)
MSLYGTMRTGVSGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMILPSGNGSYNSGGV
QTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNAS
GFTLMGYEYEAGVDPTVVVNGFDGLTRVNLASDGLIAAGSTKGSMGANLPSGAPVGDVST
TSLVVYDSQGNTRILDFNYEKTGANAWTLEIVDRASGDALTVPPVTLAFNAAGELTTSPA
TVVANGALIVPPPATGAVVGSITIDFSKTTQLGYAFNADGGSIDGNAPSKVAGYQIDSDG
IVYVKYENGKLDPRYRIALANVQSPDKLRPESGNVYSQGVDSGVIITGFAGSGDFGEILS
GALESSNVDIAEELTAMIESQRNYTANSKVFQTGSELLEVLVNLKR