Protein Info for SMc03039 in Sinorhizobium meliloti 1021

Annotation: flagellin D protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00669: Flagellin_N" amino acids 4 to 136 (133 residues), 117.4 bits, see alignment E=5.6e-38 PF00700: Flagellin_C" amino acids 315 to 399 (85 residues), 66.7 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 100% identical to FLAD_RHIME: Flagellin D (flaD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02406, flagellin (inferred from 100% identity to sme:SMc03039)

Predicted SEED Role

"Flagellin protein FlaA" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58330 at UniProt or InterPro

Protein Sequence (401 amino acids)

>SMc03039 flagellin D protein (Sinorhizobium meliloti 1021)
MTSILTNVAAMAALQTLRGIDSNMEETQARVSSGLRVGTASDNAAYWSIATTMRSDNMAL
SAVQDALGLGAAKVDTAYAGMENAVEVVKEIRAKLVAATEDGVDKAKIQEEIEQLKQQLT
SIATAASFSGENWLQADITTPVTKSVVGSFVRDSSGVVSVKTIDYVLDGNSVLFDTVGDA
GILDKIYNVSQASVTLPVNVNGTTTEYTVAAYAVDELIAAGATFDGDSANVTGYTVPAGG
IDYNGNFVKVEGTWVRAIDVAATGQEVVYDDGTTKWGVDTTVAGAPAINVVAPASIENID
ITNAAQAANLDALIRGVDEALEDLISATSALGSISMRIGMQEEFVSKLTDSIDSGIGRLV
DADMNEESTRLKALQTQQQLAIQSLSIANTNSENILQLFRQ