Protein Info for SMc03031 in Sinorhizobium meliloti 1021

Annotation: flagellar basal body P-ring biosynthesis protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03170: flagella basal body P-ring formation protein FlgA
  • amino acids 37 to 165 (129 residues), 130.4 bits, E=2.2e-42
• PF08666: SAF
  • amino acids 44 to 104 (61 residues), 35.2 bits, E=1.5e-12
• PF13144: ChapFlgA
  • amino acids 45 to 165 (121 residues), 92.6 bits, E=1.9e-30

Best Hits

Swiss-Prot: 100% identical to FLGA_RHIME: Flagellar protein FlgA (flgA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 100% identity to sme:SMc03031)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

See Q52947 at UniProt or InterPro

Protein Sequence (168 amino acids)

>SMc03031 flagellar basal body P-ring biosynthesis protein FlgA (Sinorhizobium meliloti 1021)
MFRRSPGGKANMSGRAQPARAVLFAAMASCLLSPAAALAEPPTAVIPKQTIYPGEKLDAS
MLEVVDVTNPDLRDGYVRSIDEVDGMVTKRTLLPGRVILASALREQYAVERGSTVRLVFN
NGGLTITAAGSPLQDAAVGDLIRVRNVDTGVIVSGTVMADSTIHVVAK