Protein Info for SMc03022 in Sinorhizobium meliloti 1021

Annotation: flagellar motor protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 361.9 bits, see alignment E=9.7e-113 PF20560: MotA_N" amino acids 4 to 92 (89 residues), 113.5 bits, see alignment E=4.3e-37 PF01618: MotA_ExbB" amino acids 135 to 228 (94 residues), 50.8 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 100% identical to MOTA_RHIME: Motility protein A (motA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to smk:Sinme_0348)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P97215 at UniProt or InterPro

Protein Sequence (292 amino acids)

>SMc03022 flagellar motor protein MotA (Sinorhizobium meliloti 1021)
MNIIIGLLVTFGCILGGYMAMGGHLEVLNQPFELMIIGGAGIGGFIMANSMKVVKDTGKA
LGEAFRHKVPKEREYLDTLGVLYSLMRDLRTKSRNEIESHIDNPEESSIFQSAPTVLQNK
ELTAFICDYVRLIIIGNARSHEIEALMDEEIQTITHDKMKCYHAMTTMGDALPAIGIVAA
VLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGPLVANIKSVREKQNRLYVI
VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGGSESKAA