Protein Info for SMc03019 in Sinorhizobium meliloti 1021

Annotation: flagellar motor switch protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF14842: FliG_N" amino acids 18 to 109 (92 residues), 59.4 bits, see alignment E=9.3e-20 PF14841: FliG_M" amino acids 131 to 199 (69 residues), 57 bits, see alignment E=3.7e-19 PF01706: FliG_C" amino acids 230 to 337 (108 residues), 68.8 bits, see alignment E=9.3e-23

Best Hits

Swiss-Prot: 100% identical to FLIG_RHIME: Flagellar motor switch protein FliG (fliG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 100% identity to smk:Sinme_0345)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O54244 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SMc03019 flagellar motor switch protein G (Sinorhizobium meliloti 1021)
MTDFGSFEAQAQALAQPLSQTEKAAAVLLAMGKSIAGKLLKFFTQSELQAIIAAAQSLRA
VPPHELEALVNEFEDLFTEGAGLMDNAKAMESILEEGLTPDEVDGLLGRRATFQSYEASI
WDRLMDCDPVIIAQLLAREHPQTIAYVLSMMPSSFGAKVLLQLSDKQRPEILNRAVNIKN
VNPKAAAIIEARVIEIIEEMEADRNSPGPAKIAEVMNELEKPQVDTLLASLETISTDSVK
KVRPKIFLFDDILFMPQRSRVQLFNDVSTDVITMALRGSAAELRESILASIGARQRRMIE
SDLAAGDAGINPRDIAIARRSITQEAIRLSASGQLELKEKEPEAA