Protein Info for SMc02983 in Sinorhizobium meliloti 1021

Annotation: ornithine, DAP, or arginine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01168: Ala_racemase_N
  • amino acids 24 to 216 (193 residues), 31 bits, E=3.3e-11
• PF02784: Orn_Arg_deC_N
  • amino acids 28 to 261 (234 residues), 194.3 bits, E=3.6e-61
• PF00278: Orn_DAP_Arg_deC
  • amino acids 139 to 357 (219 residues), 50.2 bits, E=3.8e-17

Best Hits

KEGG orthology group: K01581, ornithine decarboxylase [EC: 4.1.1.17] (inferred from 100% identity to smk:Sinme_2929)

Predicted SEED Role

"Ornithine decarboxylase (EC 4.1.1.17) / Arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.17, EC 4.1.1.19)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• superpathway of putrescine biosynthesis (4/4 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• putrescine biosynthesis III (2/2 steps found)
• arginine dependent acid resistance (1/1 steps found)
• cadaverine biosynthesis (1/1 steps found)
• L-lysine degradation X (4/6 steps found)
• superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
• superpathway of ornithine degradation (5/8 steps found)
• superpathway of polyamine biosynthesis I (5/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)
• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (1/3 steps found)
• aminopropylcadaverine biosynthesis (1/3 steps found)
• putrescine biosynthesis II (1/3 steps found)
• spermidine biosynthesis III (1/4 steps found)
• L-lysine degradation I (3/7 steps found)
• bisucaberin biosynthesis (1/5 steps found)
• desferrioxamine B biosynthesis (1/5 steps found)
• desferrioxamine E biosynthesis (1/5 steps found)
• lupanine biosynthesis (1/5 steps found)
• superpathway of polyamine biosynthesis II (3/8 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)
• superpathway of L-lysine degradation (15/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutathione metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.17, 4.1.1.19

Use Curated BLAST to search for 4.1.1.17 or 4.1.1.19

Sequence Analysis Tools

See Q92LY7 at UniProt or InterPro

Protein Sequence (379 amino acids)

>SMc02983 ornithine, DAP, or arginine decarboxylase (Sinorhizobium meliloti 1021)
MAMTTARIIDFLNTRRPEGPCLVVDLDVVRDNFKAFRHALPDSAIYYAVKANPAPEILRL
LAGLGSNFDCASVAEIEMALDAGATPNRISYGNTIKKERDVARAHALGISLFAVDSHEEV
EKIARAAPGARVFCRVLTDGEGAEWPLSRKFGCVPQMAVDVLVYAHQLGLVSYGVSFHVG
SQMTKLDAWDAALADAKRVFVQLAKQGIELKMVNMGGGFPTKYLRDVPSAEAYGQAIFGA
LKKHFGNNIPETIIEPGRGMVGNAGVIKAEVVLVSKKSDNDSHRWVFLDIGKFGGLAETM
DEAIRYPIRTARDADAMEPCVLAGPTCDSADVLYEKNMYPLPISLTIGDEVLIEGTGAYT
TTYSAVAFNGFEPLKAYVI