Protein Info for SMc02975 in Sinorhizobium meliloti 1021

Annotation: phosphoenolpyruvate carboxykinase regulator transcription regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 65 to 315 (251 residues), 96.9 bits, see alignment E=2.4e-31 PF13407: Peripla_BP_4" amino acids 66 to 314 (249 residues), 54.8 bits, see alignment E=1.6e-18 PF13377: Peripla_BP_3" amino acids 174 to 334 (161 residues), 115.9 bits, see alignment E=3.3e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02975)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7APB5 at UniProt or InterPro

Protein Sequence (341 amino acids)

>SMc02975 phosphoenolpyruvate carboxykinase regulator transcription regulator protein (Sinorhizobium meliloti 1021)
MVAQKVKLSTIAETLGLSTATVSLALRDSPLVAAVTRDKIKEQARALGYIYNRRAASLRT
SRSGIIGVVVHDIMNPFYGEILKAIEAELDRDKQTFILSNHYDSVEKQRDFIETLLQLGG
DGVIMSPAIGTPPQDIQLAEDNGMPAILIARSIEGLDVPIFRGDDAYGISLATNHLIGLG
HRCIAMVGGTDQTSTGRDRYQGYVNALRKANIEVDPDLRIPGPRSKQGGFEAAVHLLSLP
QKPTAVVCWNDLVAIGMMNGIARAGLVPGVDISVTGYDDLEEASIATPALTTVWNGQAEV
GRSAARALLDKLSGSHEPDGIHLIKPEMRIRQSTGPLRVTA