Protein Info for SMc02892 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 372 to 389 (18 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details amino acids 445 to 471 (27 residues), see Phobius details PF05977: MFS_3" amino acids 31 to 198 (168 residues), 42 bits, see alignment E=7e-15 PF07690: MFS_1" amino acids 32 to 424 (393 residues), 177.4 bits, see alignment E=5.9e-56 PF00083: Sugar_tr" amino acids 61 to 197 (137 residues), 32.8 bits, see alignment E=5.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02892)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SY1 at UniProt or InterPro

Protein Sequence (492 amino acids)

>SMc02892 transporter (Sinorhizobium meliloti 1021)
MFMPKPAVAAADDAAGRNPHRDASAGWALASLSLSMLLSSLGTSIANVGLPSLATAFSAS
FQQVQWVVLAYLLAITTLIVGVGRLGDMVGRRRLLLAGILLFTVASGLSGAAPSLPLLIA
ARAVQGLGAAVMMALAMALVGETVAKEKTGGAMGLLGTMSAIGTALGPSLGGVLIAGLGW
QAIFVVNVPLGALAFILARRSLPADRQGSAAERTGFDVPGTLLLGLTLAAYALAMTVAHD
SFGPLNMALLAAAVVGAGLFVLAERRATSPLMRPEALRDPVLGAGLAMSALVSTVMMATL
VVGPFYLSRALGLGEALVGIVMSAGPVVSALSGLPAGRAVDRLGAPFVIVTGLLAMAAGS
FALSVLPEMFGVAGYLAAMLVLTPGYQLFQAANNTAVMVDVRPDRRGVVSGMLNLSRNLG
LITGASVMGAVFAFASAAPDIAAAPAVAVAAGMRITFAVAGALIVSALVIALRSRTLFMR
ACAGAALRDEGR