Protein Info for SMc02880 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00480: ROK
  • amino acids 3 to 296 (294 residues), 161.4 bits, E=1.8e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02880)

Predicted SEED Role

"N-acetylmannosamine kinase (EC 2.7.1.60)" in subsystem Sialic Acid Metabolism (EC 2.7.1.60)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (4/6 steps found)
• N-acetylneuraminate and N-acetylmannosamine degradation I (2/4 steps found)
• CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (1/5 steps found)
• superpathway of CMP-sialic acids biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.60

Sequence Analysis Tools

See Q92SZ0 at UniProt or InterPro

Protein Sequence (303 amino acids)

>SMc02880 hypothetical protein (Sinorhizobium meliloti 1021)
MIVCFDIGGSAIKGAITHSPERIFPLPRRATPLTDFGRFVEAMESVLDEAGGLPERVAIS
ITGVIDPETRRIKCANIPCIDGRELVAELEAALHLPVVIANDADCFALAEAGVGAGRGHR
IVFGAILGTGVGGGLVIDGRLINADGGFAGEWGHGPAVAAAAGHPPIAIPAFPCGCGQSR
CVDTVGGARGLERLHETVHGKALSSHDIIEGWQNGNAEAARTIDVFVDLVSSPLALVINI
TGATIVPVGGGLSNAEALLAEIDRAVRARILRRFDRPLVVRGECRVEPGLIGAALLGFGG
RSA