Protein Info for SMc02879 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF03932: CutC" amino acids 5 to 202 (198 residues), 237.9 bits, see alignment E=3.7e-75

Best Hits

Swiss-Prot: 100% identical to CUTC_RHIME: Copper homeostasis protein CutC (cutC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06201, copper homeostasis protein (inferred from 100% identity to sme:SMc02879)

Predicted SEED Role

"Cytoplasmic copper homeostasis protein CutC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SZ1 at UniProt or InterPro

Protein Sequence (245 amino acids)

>SMc02879 hypothetical protein (Sinorhizobium meliloti 1021)
MSRISLEVCVDDPDGLEAAVAGGADRIELCSALGAGGLTPSPGLMAVAAPPPVPVYAMIR
PRAGDFIYHRADLEVMRRDIDAARHAGLAGVVLGASLADGRLDARMLTKLAGHAAGMGLT
LHRAFDLVPDFAEAMEIAVDLGFERILTSGGAKTAPEAVDTLERLIELSAGRISIMPGSG
ITSDTIEALVPRLAITEVHSSCSSAEPANDMRLVEMGFAAPERRRTDAAKIRAMRARLDA
PAAKA