Protein Info for SMc02874 in Sinorhizobium meliloti 1021
Annotation: N-acetylmuramic acid 6-phosphate etherase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to MURQ_DEIRA: N-acetylmuramic acid 6-phosphate etherase (murQ) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 100% identity to smk:Sinme_3526)Predicted SEED Role
"N-acetylmuramic acid 6-phosphate etherase"
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92SZ6 at UniProt or InterPro
Protein Sequence (298 amino acids)
>SMc02874 N-acetylmuramic acid 6-phosphate etherase (Sinorhizobium meliloti 1021) MPPAKTEERRDNAKGLDVMRPELALRLLAAGQQEAAKSVEQAIEPISAAARLAADSLASG GRLAYAGAGSSGLMAMADALELPGTYGIAREQVVILIAGGAASLTDLAGGYEDDMELARA DVRSAGIGAGDCLISVSASGSTPYAIAAADEAGKRGARVIGMANNAGAPLLLNADVSILL ETPPEVVSGSTRMGAGTAQKIAFNMFSTMVGIHLGHVLDGHMVNLRADNIKLRGRAIRIV SDIAGIGAADADRLLGLAGGSVKLAILLASGARDIAYAEDALERADQNLRRAIAIVGT