Protein Info for SMc02874 in Sinorhizobium meliloti 1021

Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF13580: SIS_2" amino acids 37 to 163 (127 residues), 56 bits, see alignment E=7e-19 PF22645: GKRP_SIS_N" amino acids 58 to 147 (90 residues), 32 bits, see alignment E=1.3e-11 PF01380: SIS" amino acids 125 to 206 (82 residues), 32.7 bits, see alignment E=9.2e-12

Best Hits

Swiss-Prot: 40% identical to MURQ_DEIRA: N-acetylmuramic acid 6-phosphate etherase (murQ) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 100% identity to smk:Sinme_3526)

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SZ6 at UniProt or InterPro

Protein Sequence (298 amino acids)

>SMc02874 N-acetylmuramic acid 6-phosphate etherase (Sinorhizobium meliloti 1021)
MPPAKTEERRDNAKGLDVMRPELALRLLAAGQQEAAKSVEQAIEPISAAARLAADSLASG
GRLAYAGAGSSGLMAMADALELPGTYGIAREQVVILIAGGAASLTDLAGGYEDDMELARA
DVRSAGIGAGDCLISVSASGSTPYAIAAADEAGKRGARVIGMANNAGAPLLLNADVSILL
ETPPEVVSGSTRMGAGTAQKIAFNMFSTMVGIHLGHVLDGHMVNLRADNIKLRGRAIRIV
SDIAGIGAADADRLLGLAGGSVKLAILLASGARDIAYAEDALERADQNLRRAIAIVGT