Protein Info for SMc02861 in Sinorhizobium meliloti 1021

Annotation: phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 175 to 188 (14 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 305 to 330 (26 residues), see Phobius details PF01384: PHO4" amino acids 24 to 323 (300 residues), 332.8 bits, see alignment E=1.1e-103

Best Hits

Swiss-Prot: 100% identical to PIT_RHIME: Probable low-affinity inorganic phosphate transporter (pit) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to smk:Sinme_3513)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O30499 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SMc02861 phosphate transporter (Sinorhizobium meliloti 1021)
MDATLAFPLLVGLIAVALFFDFLNGLHDAANSIATIVSTRVLRPQYAVFWAAFFNFIAFL
FFGLHVAETLGTGIIDPGIVTPQVIFAALMGAITWNIVTWVFGIPSSSSHALIGGLVGAG
LAKTGFSSIVWQGLLKTAGAIVMSPGIGFVLALLLVLIVSWLFVRQTPFAVDSTFRVLQF
VSASLYSLGHGGNDAQKTMGIIAVLLFSQGYLGSEFYVPFWVVITCQAAIALGTLFGGWR
IVHTMGSKITKLNPMQGFCAETGGAITLFAATWLGIPVSTTHTITGAIIGVGAARRVSAV
RWGLAGNIVVAWVITMPAAALISALCYFAADLVA