Protein Info for SMc02853 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 15 to 292 (278 residues), 48.4 bits, see alignment E=4.8e-17

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 100% identity to sme:SMc02853)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T11 at UniProt or InterPro

Protein Sequence (315 amino acids)

>SMc02853 hypothetical protein (Sinorhizobium meliloti 1021)
MKRLKAYFWPVVGLAAILISVRALVDELRGLSLNEFLASFQAISLESWLLAIGSTLVAYA
ALAAYDRLALDHLGHRISLWFITLCSFTTYALSHNLGASVFSGAVVRYRAYRSKGLTPGE
VGVLVAFCSFTFTLGTLMLSAIVLLLRPNIIERFSEFLPIEMSLTTGCLILALIALYVLG
SLVGMRPLRTRWFQLHYPRPSIVLRQLIIAPVELLGAAGIIYFALPEAGNPGYVVILGIF
LASFSAALLSHAPGGIGVLEFVFIAALPEMDPADVLAALAIFRLLYLLVPFVMALVVILV
FEHSRFLAERGAKEP