Protein Info for SMc02835 in Sinorhizobium meliloti 1021

Annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02685: Glucokinase
  • amino acids 14 to 323 (310 residues), 368.4 bits, E=1.4e-114
• TIGR00749: glucokinase
  • amino acids 14 to 317 (304 residues), 232.3 bits, E=4.1e-73

Best Hits

Swiss-Prot: 100% identical to GLK_RHIME: Glucokinase (glk) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to smk:Sinme_3489)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• homolactic fermentation (10/12 steps found)
• trehalose degradation II (cytosolic) (2/2 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• glycogen degradation II (4/6 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• chitin biosynthesis (6/9 steps found)
• sucrose biosynthesis II (5/8 steps found)
• trehalose degradation IV (1/3 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

See Q92T27 at UniProt or InterPro

Protein Sequence (339 amino acids)

>SMc02835 glucokinase (Sinorhizobium meliloti 1021)
MPNASEHSFPFPILIGDIGGTNARFALLTDAYGEPKQLAPIRTGDFATIEEAMQKGILDK
TSVQPRSAILAVAGPIKGDEIPLTNAGWVIRPKDMLAGLGLEDVLVINDFEAQALAIAAP
ADQDVVQIGGGAVRPFHSRVVLGPGTGLGVAGLVYAQHTWIPVPGEGGHVDIGPRTERDF
RIWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEEAVLADQAAVTTSALSGADAAAV
ETVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALTKPEFRAAFEDKAPHSALM
RTIPTFAVIHPMAALSGLAAFARTPRDFGVAMEGRRWRR