Protein Info for SMc02830 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 177 to 203 (27 residues), see Phobius details amino acids 223 to 256 (34 residues), see Phobius details amino acids 293 to 319 (27 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 57 (37 residues), 24.9 bits, see alignment 1.5e-09 PF00528: BPD_transp_1" amino acids 193 to 374 (182 residues), 103.1 bits, see alignment E=1.5e-33

Best Hits

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 100% identity to sme:SMc02830)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T32 at UniProt or InterPro

Protein Sequence (377 amino acids)

>SMc02830 ABC transporter permease (Sinorhizobium meliloti 1021)
MSTATAYAGAPEKGWLTPIGRRRWQNFKANRRGYWSLWLFLLLFGLSLFAEFIANDKPIL
ASYKGEILVPVLFDYPEEKFGGFLAETDYRSDFIRDEIGANGWMIWPPIRYSYQTVNSSI
PHSAPTPPFWLMSEEERCSAYPQGADDPGCIAGNLNWLGTDDQARDVMARMIYGFRISVL
FGLALTIASAVIGVSAGAVQGYFGGWTDLLMQRFIEIWSSMPVLYILLIIAAILPPGFFI
LLGIMLLFSWVGFVGVVRAEFLRARNFEYVNAARALGVGNGTIMYRHLLPNAMVATLTFL
PFILSGSITTLTSLDFLGFGMPPGSPSLGEMIAQGKSNLQAPWLGLTAFFAMSIMLSLLI
FVGEATRDAFDPRKTFR