Protein Info for SMc02814 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details PF07690: MFS_1" amino acids 3 to 117 (115 residues), 50.1 bits, see alignment E=1e-17 amino acids 137 to 305 (169 residues), 47.1 bits, see alignment E=8.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02814)

Predicted SEED Role

"probable transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PX7 at UniProt or InterPro

Protein Sequence (310 amino acids)

>SMc02814 transport transmembrane protein (Sinorhizobium meliloti 1021)
MGGARLAILCSGLAALTLIAIGWTQEVWAWMPLRFLLGFFANPLYVISETWLLSITPARR
RGRIMGLYSSIVSGGFAIGPLSLGLVGTQGWPPFMVGIVAFLLCGLIVLAVVPHLPKMPH
EGEATSVGGFFALAPLLLFAVFAAAALEQTLLSLFAVYGAALDSTEGRIASLITCFIAGN
AVLQILLGRVAERFGSLRTMMLCALASLGGCLLLPAIFESWLIWPLFFVWGGASFGIYTM
SLIQLGERFTGQSLIAGNAAFAFVWGIGGIVGSPATGLAMQLIGHQGLPLSLGLLCFVLA
VFLIPQLNRP