Protein Info for SMc02797 in Sinorhizobium meliloti 1021

Annotation: tRNA modification GTPase TrmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF10396: TrmE_N" amino acids 6 to 120 (115 residues), 121 bits, see alignment E=6.5e-39 TIGR00450: tRNA modification GTPase TrmE" amino acids 18 to 439 (422 residues), 255.9 bits, see alignment E=8.2e-80 PF12631: MnmE_helical" amino acids 123 to 436 (314 residues), 152.2 bits, see alignment E=4.6e-48 TIGR00231: small GTP-binding protein domain" amino acids 218 to 346 (129 residues), 70.9 bits, see alignment E=1.1e-23 PF01926: MMR_HSR1" amino acids 219 to 327 (109 residues), 72.1 bits, see alignment E=8.6e-24

Best Hits

Swiss-Prot: 100% identical to MNME_RHIME: tRNA modification GTPase MnmE (mnmE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to sme:SMc02797)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KW1 at UniProt or InterPro

Protein Sequence (439 amino acids)

>SMc02797 tRNA modification GTPase TrmE (Sinorhizobium meliloti 1021)
MLSTDTIYALSSGSLPAGVAIIRVSGPETADALVRLCGTLPPPRIATLRTIRTRNGETLD
SGLVLYFPTPASFTGEDCCELQVHGGRAVVSAILDELAATGGLRHAEAGEFARRAFQNGK
LDLVEVEGLADLIAAETEMQRRLAIEQSGGGQSALYAGWARRLTHSRAMIEAELDFADED
DVPGSVSAVIWEDVGRLRQEIDGHIARAGLAEIIRDGLKIVIAGEPNAGKSSLLNALARR
DIAIVTEVAGTTRDVLSVDLSLAGFSVKLFDTAGLRETDELVEREGIRRARQVIADADLV
LLLSEKPGHFRIDEVLPENVPVIRVATKVDRPSPSWAPSDADIFLSTRTGEGMADLLTAL
QSHLPDLAGRTALAMPSRKRHVDCLRQASAALERSLISSDLELRAEQLRQAGDALGRITG
RVDVENLLDVIFSEFCIGK