Protein Info for SMc02791 in Sinorhizobium meliloti 1021

Annotation: shikimate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00507: shikimate dehydrogenase" amino acids 14 to 277 (264 residues), 227 bits, see alignment E=1.2e-71 PF08501: Shikimate_dh_N" amino acids 14 to 98 (85 residues), 88 bits, see alignment E=6e-29 PF01488: Shikimate_DH" amino acids 131 to 199 (69 residues), 42.5 bits, see alignment E=1e-14 PF18317: SDH_C" amino acids 248 to 271 (24 residues), 27.9 bits, see alignment (E = 2.4e-10)

Best Hits

Swiss-Prot: 100% identical to AROE_RHIME: Shikimate dehydrogenase (NADP(+)) (aroE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to smk:Sinme_3335)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TF0 at UniProt or InterPro

Protein Sequence (286 amino acids)

>SMc02791 shikimate 5-dehydrogenase (Sinorhizobium meliloti 1021)
MHDSRETFVNHAFVTGYPVKHSRSPLIHGHWLKQFGIRGSYRAHEVTPEAFPDFMRQIKE
GRTDFCGGNVTIPHKEAAFRLADRPDELSAELGAANTLWLENGKIRATNTDGRGFVANLD
ERAKGWDRISAAVILGAGGASRAVIQAIRDRGVKTIHVVNRTPERARELADRFGTAVHAH
SMAALPEVVSGAGLFVNTTSLGMDGEPAPAIDFSGLAPDAVVTDIVYVPLKTPLLRQAEE
QGFRIVDGLGMLLHQAVPGFEKWFGLRPVVDETLRQIIISDMDRHA