Protein Info for SMc02785 in Sinorhizobium meliloti 1021

Annotation: lytic murein transglycosylase A protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03562: MltA
  • amino acids 92 to 257 (166 residues), 173 bits, E=5.4e-55
• PF06725: 3D
  • amino acids 280 to 356 (77 residues), 75.5 bits, E=3.2e-25

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 100% identity to sme:SMc02785)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See Q92TE5 at UniProt or InterPro

Protein Sequence (372 amino acids)

>SMc02785 lytic murein transglycosylase A protein (Sinorhizobium meliloti 1021)
MAFHLEPVSFSELPGWSADDPAPVIASLRRCHRHATEVKPYKTGSLGISVGDLLPAFEAA
GSDFSDAAAARAFFEAQFVPFRICPEEKRTGFVTAFYEPEIEVRAGPDAEFRFPFYRRPS
DLVDIDDTNRPAGMDPYFVFGRRRDGRIEEFPDRRAIEEGFLSGRGLEIAYARSKVDVFF
VHVQGAARLIYPDGSRRRITYAAKTGHRFSAVGKLLIDRGEIDAATVSMASIRAWLAAHA
DRADEVLWHNRSFIFFREAPVEEEGLGPVAAAKVPLEPGRSLAVDRLIHTFGVPFYVASE
TLTHLDGGHPFGRLMLALDTGSAIVGPARGDIFTGSGDQAGELAGCVRNDAEFFIFVPRA
ASVRYRPQSSHG