Protein Info for SMc02772 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 19 to 43 (25 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 260 to 287 (28 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 48 to 313 (266 residues), 144.9 bits, see alignment E=1.4e-46

Best Hits

Swiss-Prot: 38% identical to RBSC_ECO57: Ribose import permease protein RbsC (rbsC) from Escherichia coli O157:H7

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to sme:SMc02772)

MetaCyc: 38% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose transport system permease protein rbsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TD5 at UniProt or InterPro

Protein Sequence (324 amino acids)

>SMc02772 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MSVETVESAGPTPKKGVSILFGLTLVGLLVVLWLLLGLATNAFWTPNNISNLLRQGAMTA
ILAVGQTFVIITAGIDLSVGAVVGFTSVIVAWLLAAGVPLWLAIIATLAIGVLIGAFHAF
GIVRMGLPPFIITLATLTSLRGIGLLITNGSTISITNDAFTTFSRADFLGIPSLFWMVIV
VAIPAYVFLHLSRFGRYLFAVGSNSEAARLSGVNVNRTIYLAYILSSTCAAFVGLLLASR
IGIGNATQAEGWELQAIASSVIGGTSLFGAVGSVHGPLLGAFILATINNGANLLNVNSFW
QRIITGLLIIVIVYFDQLRRRGAR