Protein Info for SMc02764 in Sinorhizobium meliloti 1021

Annotation: acetyl-CoA carboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 2 to 284 (283 residues), 350.9 bits, E=2.7e-109
• PF01039: Carboxyl_trans
  • amino acids 93 to 242 (150 residues), 76.2 bits, E=1.1e-25

Best Hits

Swiss-Prot: 100% identical to ACCD_RHIME: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 100% identity to sme:SMc02764)

MetaCyc: 41% identical to acetyl-CoA carboxyltransferase beta subunit (Chloroflexus aurantiacus)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• methylaspartate cycle (12/19 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

See Q92TC7 at UniProt or InterPro

Protein Sequence (304 amino acids)

>SMc02764 acetyl-CoA carboxylase subunit beta (Sinorhizobium meliloti 1021)
MNWITNYVRPKINSMLGRREVPENLWIKCPETGEMVFHRDLEENKWVIPQSGFHMKMPAK
ARLKDLFDGGIYEAFPQPKVAQDPLKFRDSKKYSDRLRDSRAKTELEDTIVAGLGQVQGI
KLVAVAHEFNFIGGSLGIAAGEAIVKAFERAIAEKCPLVMFPASGGARMQEGILSLMQLP
RTTVALNMLKEAGLPYIVVLTNPTTGGVTASYAMLGDIHMAEPGAEIGFAGKRVIEQTLR
EKLPEGFQTSEYLLEHGMVDMVVKRHDIPETLARVLNILMKKPAKAVKRDTATELAPLPV
AASA