Protein Info for SMc02761 in Sinorhizobium meliloti 1021

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 3 to 103 (101 residues), 122.5 bits, E=1.7e-39
• TIGR01068: thioredoxin
  • amino acids 7 to 105 (99 residues), 135 bits, E=4.5e-44
• PF00578: AhpC-TSA
  • amino acids 18 to 67 (50 residues), 27.7 bits, E=5.8e-10
• PF13098: Thioredoxin_2
  • amino acids 19 to 101 (83 residues), 37.7 bits, E=5.7e-13
• PF13905: Thioredoxin_8
  • amino acids 20 to 62 (43 residues), 29.6 bits, E=1.9e-10
• PF14595: Thioredoxin_9
  • amino acids 24 to 95 (72 residues), 30 bits, E=1.1e-10

Best Hits

Swiss-Prot: 76% identical to THIO1_CORNE: Thioredoxin C-1 from Corynebacterium nephridii

KEGG orthology group: K03671, thioredoxin 1 (inferred from 98% identity to smd:Smed_3241)

MetaCyc: 56% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (2/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See Q92TC5 at UniProt or InterPro

Protein Sequence (107 amino acids)

>SMc02761 thioredoxin (Sinorhizobium meliloti 1021)
MATVKVDTANFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVVKLNID
ENPELAAQYGVRSIPTLAMFKGGEVADIKVGAAPKTALSSWISNAVA