Protein Info for SMc02755 in Sinorhizobium meliloti 1021

Annotation: S-adenosyl-L-homocysteine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF05221: AdoHcyase" amino acids 6 to 465 (460 residues), 491.6 bits, see alignment E=1.5e-151 TIGR00936: adenosylhomocysteinase" amino acids 7 to 458 (452 residues), 603.4 bits, see alignment E=9.9e-186 PF00670: AdoHcyase_NAD" amino acids 227 to 386 (160 residues), 264.6 bits, see alignment E=7.8e-83 PF02826: 2-Hacid_dh_C" amino acids 247 to 336 (90 residues), 27.2 bits, see alignment E=4.8e-10 PF07991: IlvN" amino acids 247 to 312 (66 residues), 20.9 bits, see alignment E=4.7e-08

Best Hits

Swiss-Prot: 100% identical to SAHH_RHIME: Adenosylhomocysteinase (ahcY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 100% identity to sme:SMc02755)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TC1 at UniProt or InterPro

Protein Sequence (466 amino acids)

>SMc02755 S-adenosyl-L-homocysteine hydrolase (Sinorhizobium meliloti 1021)
MSATQDYIVADIGLADFGRKEIAIAETEMPGLMACREEFGASKPLKGARITGSLHMTIQT
AVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGETLEEYWTYTDKIFQW
ADGGVSNMILDDGGDATMYILLGARAEAGENILTNPGSEEEEILFAQIKKRLAATPGWFT
RQRDAIKGVTEETTTGVNRLYQLQAKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGIR
RGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGARVKVTEVDPICALQAAMDGYEVVQLED
VVSSADIFITTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQVSALRNLKWTNVKPQVD
LIEFPKGNRIILLSEGRLLNLGNATGHPSFVMSASFSNQVLAQIELFTKGEQYKNEVYVL
PKQLDEKVARLHLAKLGAKLTELSEEQASYIGVKQQGPFKAEHYRY