Protein Info for SMc02736 in Sinorhizobium meliloti 1021

Annotation: thymidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to KITH_RHIME: Thymidine kinase (tdk) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00857, thymidine kinase [EC: 2.7.1.21] (inferred from 100% identity to smk:Sinme_2445)

Predicted SEED Role

"Thymidine kinase (EC 2.7.1.21)" in subsystem Folate Biosynthesis (EC 2.7.1.21)

MetaCyc Pathways

superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
pyrimidine deoxyribonucleosides salvage (4/5 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N38 at UniProt or InterPro

Protein Sequence (195 amino acids)

>SMc02736 thymidine kinase (Sinorhizobium meliloti 1021)
MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGQGRIASRIGLESEAI
PFRAEDDLHGLIERLNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGRGKVMREGAQVDVGGNEKY
VSYCRRHWDDRMREG