Protein Info for SMc02725 in Sinorhizobium meliloti 1021

Annotation: anthranilate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01815: anthranilate synthase
  • amino acids 13 to 729 (717 residues), 1408.4 bits, E=0
• PF04715: Anth_synt_I_N
  • amino acids 122 to 206 (85 residues), 32.8 bits, E=1.6e-11
• PF00425: Chorismate_bind
  • amino acids 247 to 499 (253 residues), 222.5 bits, E=1.4e-69
• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 531 to 717 (187 residues), 136.5 bits, E=9.6e-44
• PF00117: GATase
  • amino acids 532 to 708 (177 residues), 169.6 bits, E=1.2e-53
• PF07722: Peptidase_C26
  • amino acids 591 to 699 (109 residues), 49.8 bits, E=7.9e-17

Best Hits

Swiss-Prot: 100% identical to TRPE_RHIME: Anthranilate synthase (trpE(G)) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K13503, anthranilate synthase [EC: 4.1.3.27] (inferred from 100% identity to sme:SMc02725)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

See P15395 at UniProt or InterPro

Protein Sequence (729 amino acids)

>SMc02725 anthranilate synthase (Sinorhizobium meliloti 1021)
MAAVILEDGAESYTTKGGIVVTRRRREASYSDAIAGYVDRLDERRGAVFSSNYEYPGRYT
RWDTAVVDPPLAISSFGRSLWIEAYNERGEVLLALIAEDLKSVADITLGSLAARRLDLTI
NEPDRVFTEEERSKMPTVFTVLRAVTNLFHSEEDSNLGLYGAFGYDLAFQFDAIELKLSR
PDDQRDMVLFLPDEILVVDHYAAKAWIDRYDFARENLSTEGKAADIAPEPFRSVDSIPPH
GDHRPGEYAELVVKAKESFRRGDLFEVVPGQKFYERCESRPSEISNRLKAINPSPYSFFI
NLGNQEYLVGASPEMFVRVSGRRIETCPISGTIKRGDDPIADSEQILKLLNSKKDESELT
MCSDVDRNDKSRVCVPGSVKVIGRRQIEMYSRLIHTVDHIEGRLRDDMDAFDGFLSHAWA
VTVTGAPKLWAMRFIESHEKSPRAWYGGAIGMVGFNGDMNTGLTLRTIRIKDGIAEVRAG
ATLLYDSNPEEEEAETELKASAMIAAIRDAKSANSAKSARDVAAVGAGVSILLVDHEDSF
VHTLANYFRQTGASVTTVRTPVAEEIFDRVKPDLVVLSPGPGTPKDFDCKATIKKARARD
LPIFGVCLGLQALAEAYGGDLRQLAIPMHGKPSRIRVLEPGIVFSGLGKEVTVGRYHSIF
ADPSNLPREFVITAESEDGTIMGIEHSKEPVAAVQFHPESIMTLGGDAGMRMIENVVAHL
AKRAKTKAA