Protein Info for SMc02724 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 14 to 290 (277 residues), 225 bits, see alignment E=5.8e-71 PF01545: Cation_efflux" amino acids 19 to 207 (189 residues), 143.9 bits, see alignment E=5.5e-46 PF16916: ZT_dimer" amino acids 212 to 289 (78 residues), 78.5 bits, see alignment E=3.3e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02724)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N44 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SMc02724 hypothetical protein (Sinorhizobium meliloti 1021)
MTGTDNRTILRLAFWGIPLSLGVMGLKMLAWWVTGSVALLSDGLESSVNVVAAVIAYAMI
GYAAKPADADHPFGHHKAEYFSAVIEGVLIVLAALLIIWEAIPEMMAPVLLNAPTLGLAI
NFAAGVVNAIWAYVLIRAGSRHRSPALSADGQHILSDVVTSAGVLVGLLLAIATGYAILD
PLLAVIVAGNILFQGWKVISRSVDGLMDKAVPADEEEAIKAAIAANAGGSLGVHDLKTRQ
AGPAIFVDFHMVVPEAMAVGDAHDICDRIEDAIRVVHPGAGIAIHVEPEGEKAHGVRVKV
SGASRK