Protein Info for SMc02720 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent Clp protease proteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 87 to 106 (20 residues), see Phobius details PF00574: CLP_protease" amino acids 22 to 190 (169 residues), 227 bits, see alignment E=8.3e-72

Best Hits

Swiss-Prot: 100% identical to CLPP3_RHIME: ATP-dependent Clp protease proteolytic subunit 3 (clpP3) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 100% identity to sme:SMc02720)

MetaCyc: 46% identical to ClpP3 (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9X7L1 at UniProt or InterPro

Protein Sequence (195 amino acids)

>SMc02720 ATP-dependent Clp protease proteolytic subunit (Sinorhizobium meliloti 1021)
MRNDDDQEEKKTELPLGKETEANLFKSRSIFIYGTITQELAQKVCSQLVALAAASDDDIR
LFVNSPGGHVESGDSIHDMIKFVKPKVWTIGTGWVASAGALIYVAAPKEQRLCLPNTRFL
LHQPSGGTRGMASDIEIQAREIIKMNERLNRIFSEATGQPVDKIAKDTDRDYWLGAEEAK
AYGLVSRIVTSIAEI