Protein Info for SMc02695 in Sinorhizobium meliloti 1021

Annotation: GTP-dependent nucleic acid-binding protein EngD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR00092: GTP-binding protein YchF" amino acids 1 to 366 (366 residues), 507.9 bits, see alignment E=1.7e-156 PF02421: FeoB_N" amino acids 5 to 56 (52 residues), 33.1 bits, see alignment 5.7e-12 PF01926: MMR_HSR1" amino acids 5 to 121 (117 residues), 82.4 bits, see alignment E=3.9e-27 PF06071: YchF-GTPase_C" amino acids 283 to 366 (84 residues), 135.4 bits, see alignment E=9e-44

Best Hits

Swiss-Prot: 60% identical to YCHF_HAEDU: Ribosome-binding ATPase YchF (ychF) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: K06942, (no description) (inferred from 100% identity to smk:Sinme_2402)

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N65 at UniProt or InterPro

Protein Sequence (367 amino acids)

>SMc02695 GTP-dependent nucleic acid-binding protein EngD (Sinorhizobium meliloti 1021)
MGFKCGIVGLPNVGKSTLFNALTKTAAAQAANYPFCTIEPNTGEVAVPDPRMRKLADIAK
SKEIIPTRISFVDIAGLVRGASKGEGLGNQFLANIREVDAVVHVLRCFEDDDITHVEGRI
HPVEDADTIETELMLADLDSLERRAEQTRKRATGKDKESMAQLPIMEASLKLLQEGKPVR
TLLSKLDADELRILQSLNLLTSHPVLYVCNVAESDAATGNEHTRAVEKMAREQGAETVVI
SAAIESEVAQLPEEEAKEFLAALGLEEAGLDRLIRAGYKLLDLITYFTVGPKETRAWTIP
RGTKAPQAAGVIHSDFERGFIRANTIAYDDYIGYGGENGAKEAGKARDEGKEYVVQDGDV
IHFRFNT