Protein Info for SMc02694 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent Clp protease adaptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF02617: ClpS" amino acids 18 to 96 (79 residues), 86.1 bits, see alignment E=5.7e-29

Best Hits

Swiss-Prot: 100% identical to CLPS2_RHIME: ATP-dependent Clp protease adapter protein ClpS 2 (clpS2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 99% identity to smk:Sinme_2401)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N66 at UniProt or InterPro

Protein Sequence (101 amino acids)

>SMc02694 ATP-dependent Clp protease adaptor (Sinorhizobium meliloti 1021)
MSDNDVAAKRLTKPKLERPKLYKVLLVNDDFTPREFVVMVLKAVFRMSEEAGYRVMMTAH
KMGISVVVVCAKDVAETKAKEATDLGKEAGFPLLFTAEPEE