Protein Info for SMc02691 in Sinorhizobium meliloti 1021

Annotation: membrane transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 24 to 49 (26 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 268 to 296 (29 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 372 to 402 (31 residues), see Phobius details TIGR00843: benzoate transporter" amino acids 19 to 399 (381 residues), 262.9 bits, see alignment E=2.5e-82 PF03594: BenE" amino acids 21 to 401 (381 residues), 337.8 bits, see alignment E=4.2e-105

Best Hits

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 100% identity to sme:SMc02691)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N69 at UniProt or InterPro

Protein Sequence (410 amino acids)

>SMc02691 membrane transporter (Sinorhizobium meliloti 1021)
MLLETIFPTRRNIRLSAMLRDFSVQSLFMGVLIAFVGFASSFAVVLHGLTGVGANEAQAA
SGLMALSISMGVCAILVSTVTRLPVSIAWSTPGAALLASSGVVEGGFNAAVGAFLVCGLL
IIIAGLWKPLGRIVSAIPPALANAMLAGVLLSLCFAPVKAIAFNPLFGLPIVLAWAVVGS
VSRLYAVPAALIAFVLVVALGIDMPEGALAGLSAALVPQAEFVSPSFSASALISIALPLF
IVTMASQNIPGIAVLKVNDYHPDPGPLFATTGLFTLLSAPFGGHAVNLAAITAAMCAGSD
SHPDRARRYWSSINAGIAYVVFGLLAGAVTTFVSLAPSVLIEAVAGLALIGAFSSSAVAA
FTNAETREAAAITFLVTASGVGFAGVSGAFWGLVAGGLMLALARFAKGKG