Protein Info for SMc02661 in Sinorhizobium meliloti 1021

Annotation: toxin secretion ATP-binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 25 to 286 (262 residues), 138 bits, see alignment E=7.6e-44 PF00005: ABC_tran" amino acids 357 to 504 (148 residues), 106.1 bits, see alignment E=3.5e-34

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to sme:SMc02661)

Predicted SEED Role

"RTX toxin transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R30 at UniProt or InterPro

Protein Sequence (559 amino acids)

>SMc02661 toxin secretion ATP-binding ABC transporter protein (Sinorhizobium meliloti 1021)
MVDNLRLAPLSWFTRTTFFYTPLMIELMIVAIVMRLLGLVQPFVFQAVIDRVLPFQREAT
LLLIVVVLGVTAILSAILDALAAYLGNHMGNRLTLDLAGRIFRHVLHLPLRQLQCWRVGE
TLTRISEIDTVKAFLTGTVSSILVDLLFAIIYVAALITISPMLTLIVLIVLPLQVIAFGV
IGPLTRRRMQRAFLDYSRHQSRLVETLANVVTVKALGCEAVQSERLNRTLADSLLAGFEV
TKLHIVNGFTGGLLGNVSVISIVFFGSHLVLRNEITLGQLIAFHLLADKVAGPILSLSAV
WEQWQALRIARLRLGDLLNAAAETDISKPPLPVSGRLSLHLEAVSFCYLPEQPVILDLTL
EISPDRPTVITGPSGCGKSTLAKLISGIYRPDCGVVEANGHKLTDYDERSVRQAITYLPQ
EPELFSGSVQDNILLGNAAATDQEIRSALVESGCDLFIGELPNGILTDVGERGAYLSGGQ
RQRIALARALVSPSRALILDEPTSALDSASADIVIAAIKRHAVKSTVIIVTHNPELFGSD
VNMVNIAQLQRPSDSSRQT