Protein Info for SMc02648 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details PF00230: MIP" amino acids 2 to 151 (150 residues), 80.5 bits, see alignment E=7.9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0870)

MetaCyc: 100% identical to aquaglyceroporin (Sinorhizobium meliloti)
TRANS-RXN0-551

Predicted SEED Role

"Aquaporin Z"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R43 at UniProt or InterPro

Protein Sequence (233 amino acids)

>SMc02648 transport transmembrane protein (Sinorhizobium meliloti 1021)
MQEFDLTRRCVAEALGTGLLVAAVVGSGIMADALTADDALALVANTIATGAILVVLVTIL
GPLSGAHFNPAVSLVFALSGRLTRRDCAAYVIAQVAGAIAGTALAHLMFDLPPLDMSMKV
RTGPAQWLSEGVAAFGLVATILAGIRFHREAVPWLVGLYITAAYWFTASTSFANPAVALA
RSFTNTFSGIRPGDLPGFVIAELLGAVCALALMRWLLQPARPIIRQTSPETAP